PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT01865
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 120aa    MW: 12667.2 Da    PI: 4.2967
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT01865genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-13242848
                     HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     Ede+lv +++ +G g W + +++ g++R++k+c++rw++yl
         EMT01865  2 EDEILVSYINDHGEGKWGSLPKRAGLNRCGKSCRLRWLNYL 42
                     9***************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.5E-4144IPR001005SANT/Myb domain
PROSITE profilePS5129419.039146IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-19259IPR009057Homeodomain-like
CDDcd001672.51E-8242No hitNo description
PfamPF002491.6E-11242IPR001005SANT/Myb domain
SuperFamilySSF466891.63E-14259IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MEDEILVSYI NDHGEGKWGS LPKRAGLNRC GKSCRLRWLN YLRPGIKRGN ISDDEEELIG  60
IELGFMMSPW SGGADGVGDQ HFGAPGAEAD GLEELLGLGV AGGGGDGHGG LGDLELAWLC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2796373e-99KP279637.1 Aegilops tauschii myb10-D1e (myb10-D1) gene, myb10-D1e allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FJA24e-27TT2_ARATH; Transcription factor TT2
TrEMBLN1QPQ41e-79N1QPQ4_AEGTA; Uncharacterized protein
STRINGMLOC_21581.16e-34(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.18e-28MYB family protein